SCOPe 2.05: Domain d3meea1: 3mee A:1-429

Lineage for d3meea1 (3mee A:1-429)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries)

8. Domain d3meea1: 3mee A:1-429 [199833]
   Other proteins in same PDB: d3meea2, d3meeb_
   automated match to d1c1ba2
   complexed with so4, t27

Details for d3meea1

PDB Entry: 3mee, 2.4 Å

PDB Description: hiv-1 reverse transcriptase in complex with tmc278

PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3meea1:

Sequence; same for both SEQRES and ATOM records:

>d3meea1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d3meea1:

• d3meea1 first appeared in SCOPe 2.03
  
• d3meea1 appears in SCOPe 2.04
  
• d3meea1 appears in SCOPe 2.06
  
• d3meea1 appears in the current release, SCOPe 2.08