SCOPe 2.05: Domain d3meea2: 3mee A:430-552

Lineage for d3meea2 (3mee A:430-552)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)

8. Domain d3meea2: 3mee A:430-552 [199834]
   Other proteins in same PDB: d3meea1, d3meeb_
   automated match to d1c1ba1
   complexed with so4, t27

Details for d3meea2

PDB Entry: 3mee, 2.4 Å

PDB Description: hiv-1 reverse transcriptase in complex with tmc278

PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3meea2:

Sequence; same for both SEQRES and ATOM records:

>d3meea2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d3meea2:

• d3meea2 first appeared in SCOPe 2.03
  
• d3meea2 appears in SCOPe 2.04
  
• d3meea2 appears in SCOPe 2.06
  
• d3meea2 appears in the current release, SCOPe 2.08