SCOPe 2.04: Domain d3mcfa_: 3mcf A:

Lineage for d3mcfa_ (3mcf A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries)

8. Domain d3mcfa_: 3mcf A: [199827]
   automated match to d3mcfb_
   complexed with flc, gol

Details for d3mcfa_

PDB Entry: 3mcf, 2 Å

PDB Description: crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha

PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

SCOPe Domain Sequences for d3mcfa_:

Sequence, based on SEQRES records:

>d3mcfa_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpv
haeyleklkahhhhhh

Sequence, based on observed residues (ATOM records):

>d3mcfa_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeyle
klkahhhhhh

Timeline for d3mcfa_:

• d3mcfa_ first appeared in SCOPe 2.03
  
• d3mcfa_ appears in SCOPe 2.05
  
• d3mcfa_ appears in the current release, SCOPe 2.08, called d3mcfa1