Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
Protein Beta chain [55099] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries) |
Domain d3m32b1: 3m32 B:2-188 [199811] Other proteins in same PDB: d3m32a1, d3m32a2, d3m32b2, d3m32c_, d3m32d1, d3m32d2, d3m32e2, d3m32f_ automated match to d1hbnb2 complexed with act, com, edo, f43, mg, peg, sht, tp7, zn |
PDB Entry: 3m32 (more details), 1.35 Å
SCOPe Domain Sequences for d3m32b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m32b1 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi pqklegp
Timeline for d3m32b1: