Lineage for d3m30a1 (3m30 A:2-269)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911012Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1911046Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1911047Protein Alpha chain [55095] (3 species)
  7. 1911048Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 1911059Domain d3m30a1: 3m30 A:2-269 [199801]
    Other proteins in same PDB: d3m30a2, d3m30b1, d3m30b2, d3m30c_, d3m30d2, d3m30e1, d3m30e2, d3m30f_
    automated match to d1hbna2
    complexed with act, com, edo, f43, mg, peg, tp7, xp9, zn

Details for d3m30a1

PDB Entry: 3m30 (more details), 1.45 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (A:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m30a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m30a1 d.58.31.2 (A:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d3m30a1:

Click to download the PDB-style file with coordinates for d3m30a1.
(The format of our PDB-style files is described here.)

Timeline for d3m30a1: