| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
| Protein Beta chain [55099] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries) |
| Domain d3m2rb1: 3m2r B:2-188 [199779] Other proteins in same PDB: d3m2ra1, d3m2ra2, d3m2rb2, d3m2rc_, d3m2rd1, d3m2rd2, d3m2re2, d3m2rf_ automated match to d1hbnb2 complexed with com, edo, f43, mg, peg, tp7, tpz, zn |
PDB Entry: 3m2r (more details), 1.3 Å
SCOPe Domain Sequences for d3m2rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2rb1 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp
Timeline for d3m2rb1: