SCOPe 2.08: Domain d3lkoa1: 3lko A:1-181

Lineage for d3lkoa1 (3lko A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (16 PDB entries)
   Uniprot P30685 25-300

8. Domain d3lkoa1: 3lko A:1-181 [199737]
   Other proteins in same PDB: d3lkoa2, d3lkob1, d3lkob2
   automated match to d1xh3a2

Details for d3lkoa1

PDB Entry: 3lko, 1.8 Å

PDB Description: Crystal Structure of HLA B*3501 in complex with influenza NP418 epitope from 1934 strain

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3lkoa1:

Sequence; same for both SEQRES and ATOM records:

>d3lkoa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d3lkoa1:

• d3lkoa1 first appeared in SCOPe 2.03
  
• d3lkoa1 appears in SCOPe 2.07