SCOP 1.73: Domain d2iffh1: 2iff H:2-116

Lineage for d2iffh1 (2iff H:2-116)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d2iffh1: 2iff H:2-116 [19973]
   Other proteins in same PDB: d2iffh2, d2iffl1, d2iffl2, d2iffy_
   part of Fab HyHEL-5
   mutant

Details for d2iffh1

PDB Entry: 2iff, 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

PDB Compounds: (H:) igg1 hyhel-5 fab (heavy chain)

SCOP Domain Sequences for d2iffh1:

Sequence; same for both SEQRES and ATOM records:

>d2iffh1 b.1.1.1 (H:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvss

Timeline for d2iffh1:

• d2iffh1 first appeared (with stable ids) in SCOP 1.55
  
• d2iffh1 appears in SCOP 1.71
  
• d2iffh1 appears in SCOP 1.75
  
• d2iffh1 appears in the current release, SCOPe 2.08