Lineage for d3l9re2 (3l9r E:184-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361228Species Cow (Bos taurus) [TaxId:9913] [225911] (2 PDB entries)
  8. 2361231Domain d3l9re2: 3l9r E:184-277 [199722]
    Other proteins in same PDB: d3l9ra1, d3l9ra3, d3l9rb_, d3l9rc1, d3l9rc3, d3l9rd_, d3l9re1, d3l9re3, d3l9rf_, d3l9rg1, d3l9rg3, d3l9rh_
    automated match to d1gzqa1
    complexed with cl, gol, l9q, l9r, nag

Details for d3l9re2

PDB Entry: 3l9r (more details), 2.3 Å

PDB Description: crystal structure of bovine cd1b3 with endogenously bound ligands
PDB Compounds: (E:) CD1b3

SCOPe Domain Sequences for d3l9re2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9re2 b.1.1.2 (E:184-277) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgptpgpgrlllvchvsgfypkpvrvmwmrgeqeqpgtqqgdlmpnadwtw
ylrvtlnvaageaaglncrvkhsslgdqdiilyw

SCOPe Domain Coordinates for d3l9re2:

Click to download the PDB-style file with coordinates for d3l9re2.
(The format of our PDB-style files is described here.)

Timeline for d3l9re2: