Lineage for d3kkkb_ (3kkk B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610508Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1610509Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1610510Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1610562Protein automated matches [190196] (7 species)
    not a true protein
  7. 1610615Species Plasmodium falciparum [TaxId:36329] [189120] (1 PDB entry)
  8. 1610617Domain d3kkkb_: 3kkk B: [199624]
    automated match to d3kkkd_
    mutant

Details for d3kkkb_

PDB Entry: 3kkk (more details), 2.08 Å

PDB Description: y92c catalytic residue mutant of phosphoglycerate mutase from plasmodium falciparum
PDB Compounds: (B:) phosphoglycerate mutase

SCOPe Domain Sequences for d3kkkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkkb_ c.60.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl
kraictawnvlktadllhvpvvktwrlnerhcgslqglnksetakkygeeqvkiwrrsyd
ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm
vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyyll

SCOPe Domain Coordinates for d3kkkb_:

Click to download the PDB-style file with coordinates for d3kkkb_.
(The format of our PDB-style files is described here.)

Timeline for d3kkkb_: