![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (28 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (7 PDB entries) |
![]() | Domain d3i9sa_: 3i9s A: [199543] automated match to d3i9sd_ complexed with cl, so4 |
PDB Entry: 3i9s (more details), 2.2 Å
SCOPe Domain Sequences for d3i9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9sa_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} sveikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaaveh dkvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrldw taestnptagkfyksigaslirekeyyrfegnglnklaksl
Timeline for d3i9sa_: