SCOP 1.71: Domain d1a7ql_: 1a7q L:

Lineage for d1a7ql_ (1a7q L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1a7ql_: 1a7q L: [19954]
   Other proteins in same PDB: d1a7qh_
   part of Fv D1.3
   mutant

Details for d1a7ql_

PDB Entry: 1a7q, 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) high affinity expressed variant containing ser26l->gly, ile29l->thr, glu81l->asp, thr97l->ser, pro240h->leu, asp258h->ala, lys281h->glu, asn283h->asp and leu312h->val

SCOP Domain Sequences for d1a7ql_:

Sequence; same for both SEQRES and ATOM records:

>d1a7ql_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspaslsasvgetvtitcraggnthnylawyqqkqgkspqllvyytttlaagvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstprsfgggtklei

Timeline for d1a7ql_:

• d1a7ql_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7ql_ appears in SCOP 1.69
  
• d1a7ql_ appears in SCOP 1.73
  
• d1a7ql_ appears in the current release, SCOPe 2.08