Lineage for d3hujf1 (3huj F:2-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367058Domain d3hujf1: 3huj F:2-118 [199530]
    Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje2, d3hujf2, d3hujg2, d3hujh2
    automated match to d1ktke1
    complexed with agh, mg, nag, ndg

Details for d3hujf1

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (F:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3hujf1:

Sequence, based on SEQRES records: (download)

>d3hujf1 b.1.1.0 (F:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
sestvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d3hujf1 b.1.1.0 (F:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
sestvsrirtehfpltlesarpshtsqylcassglrdlyeqyfgpgtrltvte

SCOPe Domain Coordinates for d3hujf1:

Click to download the PDB-style file with coordinates for d3hujf1.
(The format of our PDB-style files is described here.)

Timeline for d3hujf1: