Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3hujf1: 3huj F:2-118 [199530] Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje2, d3hujf2, d3hujg2, d3hujh2 automated match to d1ktke1 complexed with agh, mg, nag, ndg |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujf1:
Sequence, based on SEQRES records: (download)
>d3hujf1 b.1.1.0 (F:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls sestvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvte
>d3hujf1 b.1.1.0 (F:2-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls sestvsrirtehfpltlesarpshtsqylcassglrdlyeqyfgpgtrltvte
Timeline for d3hujf1: