SCOPe 2.08: Domain d3hi6y1: 3hi6 Y:2-106

Lineage for d3hi6y1 (3hi6 Y:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3hi6y1: 3hi6 Y:2-106 [199513]
   Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6h_, d3hi6l2, d3hi6x_, d3hi6y2
   automated match to d3fcta1
   complexed with mn, so4

Details for d3hi6y1

PDB Entry: 3hi6, 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57

PDB Compounds: (Y:) light chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6y1:

Sequence; same for both SEQRES and ATOM records:

>d3hi6y1 b.1.1.0 (Y:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvpsr
fsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveik

Timeline for d3hi6y1:

• d3hi6y1 first appeared in SCOPe 2.03
  
• d3hi6y1 appears in SCOPe 2.07