SCOPe 2.08: Domain d3hi6h_: 3hi6 H:

Lineage for d3hi6h_ (3hi6 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3hi6h_: 3hi6 H: [408390]
   Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6l1, d3hi6l2, d3hi6y1, d3hi6y2
   automated match to d6shgh_
   complexed with mn, so4

Details for d3hi6h_

PDB Entry: 3hi6, 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57

PDB Compounds: (H:) Heavy chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6h_:

Sequence, based on SEQRES records:

>d3hi6h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsryvmwwvrqapgkglewvsyiwpsggntyy
adsvkgrftisrdnskntlylqmnslraedtavyycassydfwsnafdiwgqgtmvtvss
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves

Sequence, based on observed residues (ATOM records):

>d3hi6h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsryvmwwvrqapgkglewvsyiwpsggntyy
adsvkgrftisrdnskntlylqmnslraedtavyycassydfwsnafdiwgqgtmvtvss
astkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtktytcnvdhkpsntkvdkrves

Timeline for d3hi6h_:

• d3hi6h_ is new in SCOPe 2.08-stable