SCOPe 2.07: Domain d3gbml2: 3gbm L:108-213

Lineage for d3gbml2 (3gbm L:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d3gbml2: 3gbm L:108-213 [199437]
   Other proteins in same PDB: d3gbma1, d3gbma2, d3gbmb1, d3gbmb2, d3gbmc1, d3gbmc2, d3gbmd_, d3gbml1, d3gbmm1
   automated match to d1aqkl2
   complexed with bma, edo, gol, nag

Details for d3gbml2

PDB Entry: 3gbm, 2.7 Å

PDB Description: crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.

PDB Compounds: (L:) antibody (Fab)

SCOPe Domain Sequences for d3gbml2:

Sequence; same for both SEQRES and ATOM records:

>d3gbml2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d3gbml2:

• d3gbml2 first appeared in SCOPe 2.03
  
• d3gbml2 appears in SCOPe 2.06
  
• d3gbml2 appears in the current release, SCOPe 2.08