SCOPe 2.02: Domain d1frgh1: 1frg H:218-336

Lineage for d1frgh1 (1frg H:218-336)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (53 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1frgh1: 1frg H:218-336 [19925]
   Other proteins in same PDB: d1frgh2, d1frgl1, d1frgl2
   part of Fab 26/9

Details for d1frgh1

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

PDB Compounds: (H:) igg2a 26/9 fab (heavy chain)

SCOPe Domain Sequences for d1frgh1:

Sequence; same for both SEQRES and ATOM records:

>d1frgh1 b.1.1.1 (H:218-336) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvs

Timeline for d1frgh1:

• d1frgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1frgh1 appears in SCOPe 2.01
  
• d1frgh1 appears in SCOPe 2.03
  
• d1frgh1 appears in the current release, SCOPe 2.08