Lineage for d3cada_ (3cad A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442983Protein automated matches [190329] (6 species)
    not a true protein
  7. 1443015Species Mouse (Mus musculus) [TaxId:10090] [187300] (4 PDB entries)
  8. 1443021Domain d3cada_: 3cad A: [199175]
    automated match to d3cadb_

Details for d3cada_

PDB Entry: 3cad (more details), 2.6 Å

PDB Description: Crystal structure of Natural Killer Cell Receptor, Ly49G
PDB Compounds: (A:) Lectin-related NK cell receptor LY49G1

SCOPe Domain Sequences for d3cada_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cada_ d.169.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ekywfcygikcyyfdmdrktwsgckqtcqisslsllkidnedelkflqnlapsdiswigf
sydnkkkdwawidngpsklalnttkynirdglcmslsktrldngdcgksyicicgkrldk
fph

SCOPe Domain Coordinates for d3cada_:

Click to download the PDB-style file with coordinates for d3cada_.
(The format of our PDB-style files is described here.)

Timeline for d3cada_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cadb_