Lineage for d3cadb_ (3cad B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059
Protein automated matches [190329] (6 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187300] (4 PDB entries) 
Domain d3cadb_: 3cad B: [195143]
automated match to d3g8ka_
Details for d3cadb_
PDB Entry: 3cad (more details), 2.6 Å
PDB Description: Crystal structure of Natural Killer Cell Receptor, Ly49G
PDB Compounds: (B:) Lectin-related NK cell receptor LY49G1SCOPe Domain Sequences for d3cadb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cadb_ d.169.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gfekywfcygikcyyfdmdrktwsgckqtcqisslsllkidnedelkflqnlapsdiswi
gfsydnkkkdwawidngpsklalnttkynirdglcmslsktrldngdcgksyicicgkrl
dkfph
SCOPe Domain Coordinates for d3cadb_:
Click to download the PDB-style file with coordinates for d3cadb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cadb_:
- d3cadb_ first appeared in SCOPe 2.02
- d3cadb_ appears in SCOPe 2.04
- d3cadb_ appears in the current release, SCOPe 2.08
View in 3D
