Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d3bn9e2: 3bn9 E:108-211 [199112] Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9d1, d3bn9d2, d3bn9e1, d3bn9f1, d3bn9f2 automated match to d1rhha2 complexed with edo, so4 |
PDB Entry: 3bn9 (more details), 2.17 Å
SCOPe Domain Sequences for d3bn9e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bn9e2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3bn9e2: