Lineage for d3bn9e2 (3bn9 E:108-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029466Domain d3bn9e2: 3bn9 E:108-211 [199112]
    Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c1, d3bn9d1, d3bn9d2, d3bn9e1, d3bn9f1, d3bn9f2
    automated match to d1rhha2
    complexed with edo, so4

Details for d3bn9e2

PDB Entry: 3bn9 (more details), 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2
PDB Compounds: (E:) E2 Fab Light Chain

SCOPe Domain Sequences for d3bn9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn9e2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d3bn9e2:

Click to download the PDB-style file with coordinates for d3bn9e2.
(The format of our PDB-style files is described here.)

Timeline for d3bn9e2: