Lineage for d3bffb_ (3bff B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690923Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)
  8. 1690925Domain d3bffb_: 3bff B: [199090]
    automated match to d3bffd_
    complexed with fpm, scn, sfr

Details for d3bffb_

PDB Entry: 3bff (more details), 1.9 Å

PDB Description: class a beta-lactamase sed-g238c complexed with faropenem
PDB Compounds: (B:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bffb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bffb_ e.3.1.1 (B:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

SCOPe Domain Coordinates for d3bffb_:

Click to download the PDB-style file with coordinates for d3bffb_.
(The format of our PDB-style files is described here.)

Timeline for d3bffb_: