Lineage for d3b8hc5 (3b8h C:726-842)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953476Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species)
  7. 2953477Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries)
    Uniprot P32324
  8. 2953482Domain d3b8hc5: 3b8h C:726-842 [199069]
    Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha4, d3b8hb1, d3b8hb2, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc4, d3b8hd1, d3b8hd2, d3b8he1, d3b8he2, d3b8he3, d3b8he4, d3b8hf1, d3b8hf2
    automated match to d1n0vc5
    protein/RNA complex; complexed with nad
    has additional insertions and/or extensions that are not grouped together

Details for d3b8hc5

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d3b8hc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8hc5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d3b8hc5:

Click to download the PDB-style file with coordinates for d3b8hc5.
(The format of our PDB-style files is described here.)

Timeline for d3b8hc5: