![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries) Uniprot P32324 |
![]() | Domain d3b8hc3: 3b8h C:482-560 [199067] Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha4, d3b8ha5, d3b8hb1, d3b8hb2, d3b8hc1, d3b8hc2, d3b8hc4, d3b8hc5, d3b8hd1, d3b8hd2, d3b8he1, d3b8he2, d3b8he4, d3b8he5, d3b8hf1, d3b8hf2 automated match to d1n0vc4 protein/RNA complex; complexed with nad |
PDB Entry: 3b8h (more details), 2.5 Å
SCOPe Domain Sequences for d3b8hc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8hc3 d.58.11.1 (C:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d3b8hc3:
![]() Domains from same chain: (mouse over for more information) d3b8hc1, d3b8hc2, d3b8hc4, d3b8hc5 |