Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d3arbd1: 3arb D:3-118 [198908] Other proteins in same PDB: d3arba1, d3arba2, d3arbb_, d3arbc2, d3arbd2 automated match to d1ktke1 complexed with d12, fee, nag, peg |
PDB Entry: 3arb (more details), 2.7 Å
SCOPe Domain Sequences for d3arbd1:
Sequence, based on SEQRES records: (download)
>d3arbd1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle
>d3arbd1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdeqffgpgtrltvle
Timeline for d3arbd1: