Lineage for d3arbd1 (3arb D:3-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760392Domain d3arbd1: 3arb D:3-118 [198908]
    Other proteins in same PDB: d3arba1, d3arba2, d3arba3, d3arbb_, d3arbc2, d3arbd2
    automated match to d1ktke1
    complexed with d12, fee, nag, peg

Details for d3arbd1

PDB Entry: 3arb (more details), 2.7 Å

PDB Description: ternary crystal structure of the nkt tcr-cd1d-alpha-galactosylceramide analogue-och
PDB Compounds: (D:) NKT Vbeta8.2,NKT Vbeta8.2

SCOPe Domain Sequences for d3arbd1:

Sequence, based on SEQRES records: (download)

>d3arbd1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle

Sequence, based on observed residues (ATOM records): (download)

>d3arbd1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdeqffgpgtrltvle

SCOPe Domain Coordinates for d3arbd1:

Click to download the PDB-style file with coordinates for d3arbd1.
(The format of our PDB-style files is described here.)

Timeline for d3arbd1: