SCOPe 2.07: Domain d3arbc1: 3arb C:1-117

Lineage for d3arbc1 (3arb C:1-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3arbc1: 3arb C:1-117 [198906]
   Other proteins in same PDB: d3arba1, d3arba2, d3arba3, d3arbb_, d3arbc2, d3arbd2
   automated match to d1qrnd1
   complexed with d12, fee, nag, peg

Details for d3arbc1

PDB Entry: 3arb, 2.7 Å

PDB Description: ternary crystal structure of the nkt tcr-cd1d-alpha-galactosylceramide analogue-och

PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arbc1:

Sequence; same for both SEQRES and ATOM records:

>d3arbc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d3arbc1:

• d3arbc1 first appeared in SCOPe 2.03
  
• d3arbc1 appears in SCOPe 2.06
  
• d3arbc1 appears in the current release, SCOPe 2.08