| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (42 species) not a true protein |
| Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226006] (4 PDB entries) |
| Domain d3a5mc1: 3a5m C:6-146 [198831] Other proteins in same PDB: d3a5mc2, d3a5ms_ automated match to d1d4xa1 complexed with atp, ca, mg |
PDB Entry: 3a5m (more details), 2.4 Å
SCOPe Domain Sequences for d3a5mc1:
Sequence, based on SEQRES records: (download)
>d3a5mc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfe
tfntpamyvaiqavlslyasg
>d3a5mc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvdsyvgdeaqskrgiltlkyp
iehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfetfntp
amyvaiqavlslyasg
Timeline for d3a5mc1: