SCOPe 2.04: Domain d2zxwb1: 2zxw B:1-90

Lineage for d2zxwb1 (2zxw B:1-90)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (25 PDB entries)

8. Domain d2zxwb1: 2zxw B:1-90 [198817]
   Other proteins in same PDB: d2zxwa_, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
   automated match to d1v54b2
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwb1

PDB Entry: 2zxw, 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2zxwb1:

Sequence; same for both SEQRES and ATOM records:

>d2zxwb1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2zxwb1:

• d2zxwb1 first appeared in SCOPe 2.03
  
• d2zxwb1 appears in SCOPe 2.05
  
• d2zxwb1 appears in the current release, SCOPe 2.08