Lineage for d2y8ub_ (2y8u B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352434Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1352508Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1352667Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 1352668Protein automated matches [195982] (1 species)
    not a true protein
  7. 1352669Species Emericella nidulans [TaxId:162425] [195983] (1 PDB entry)
  8. 1352671Domain d2y8ub_: 2y8u B: [198693]
    automated match to d2y8ua_
    complexed with cl, co, na, po4

Details for d2y8ub_

PDB Entry: 2y8u (more details), 1.99 Å

PDB Description: a. nidulans chitin deacetylase
PDB Compounds: (B:) chitin deacetylase

SCOPe Domain Sequences for d2y8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y8ub_ c.6.2.0 (B:) automated matches {Emericella nidulans [TaxId: 162425]}
rvptgqvitqcttpntialtfddgpseytpqlldllsrysaratffvlgdaaaqnpgllq
rmrdeghqvgahtydhvslpslgydgiasqmtrleevirpalgvapaymrppyletnelv
lqvmrdldyrvisasvdtkdyenqdadaiintsfqlfldqldaggnivlahdihywtvas
laermlqevnargliattvgdclgdgeiawyh

SCOPe Domain Coordinates for d2y8ub_:

Click to download the PDB-style file with coordinates for d2y8ub_.
(The format of our PDB-style files is described here.)

Timeline for d2y8ub_: