| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
| Family c.6.2.0: automated matches [195981] (1 protein) not a true family |
| Protein automated matches [195982] (7 species) not a true protein |
| Species Emericella nidulans [TaxId:162425] [195983] (1 PDB entry) |
| Domain d2y8ub_: 2y8u B: [198693] automated match to d2y8ua_ complexed with cl, co, na, po4 |
PDB Entry: 2y8u (more details), 1.99 Å
SCOPe Domain Sequences for d2y8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y8ub_ c.6.2.0 (B:) automated matches {Emericella nidulans [TaxId: 162425]}
rvptgqvitqcttpntialtfddgpseytpqlldllsrysaratffvlgdaaaqnpgllq
rmrdeghqvgahtydhvslpslgydgiasqmtrleevirpalgvapaymrppyletnelv
lqvmrdldyrvisasvdtkdyenqdadaiintsfqlfldqldaggnivlahdihywtvas
laermlqevnargliattvgdclgdgeiawyh
Timeline for d2y8ub_: