Lineage for d2mcph1 (2mcp H:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287896Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1287960Domain d2mcph1: 2mcp H:1-121 [19861]
    Other proteins in same PDB: d2mcph2, d2mcpl1, d2mcpl2
    part of Fab MCPC603
    complexed with pc

Details for d2mcph1

PDB Entry: 2mcp (more details), 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
PDB Compounds: (H:) iga-kappa mcpc603 fab (heavy chain)

SCOPe Domain Sequences for d2mcph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcph1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

SCOPe Domain Coordinates for d2mcph1:

Click to download the PDB-style file with coordinates for d2mcph1.
(The format of our PDB-style files is described here.)

Timeline for d2mcph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcph2