Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries) |
Domain d2mcph1: 2mcp H:1-121 [19861] Other proteins in same PDB: d2mcph2, d2mcpl2 |
PDB Entry: 2mcp (more details), 3.1 Å
SCOP Domain Sequences for d2mcph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcph1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain} evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv s
Timeline for d2mcph1: