Lineage for d2mcph1 (2mcp H:1-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7777Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries)
  8. 7782Domain d2mcph1: 2mcp H:1-121 [19861]
    Other proteins in same PDB: d2mcph2, d2mcpl2

Details for d2mcph1

PDB Entry: 2mcp (more details), 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcph1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

SCOP Domain Coordinates for d2mcph1:

Click to download the PDB-style file with coordinates for d2mcph1.
(The format of our PDB-style files is described here.)

Timeline for d2mcph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcph2