SCOP 1.55: Domain d2mcph1: 2mcp H:1-121

Lineage for d2mcph1 (2mcp H:1-121)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries)

8. Domain d2mcph1: 2mcp H:1-121 [19861]
   Other proteins in same PDB: d2mcph2, d2mcpl2

Details for d2mcph1

PDB Entry: 2mcp, 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcph1:

Sequence; same for both SEQRES and ATOM records:

>d2mcph1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

Timeline for d2mcph1:

• d2mcph1 appears in SCOP 1.57
  
• d2mcph1 appears in the current release, SCOPe 2.08