Lineage for d2vytb1 (2vyt B:31-126)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537486Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 1537517Protein Scml2 protein [89300] (1 species)
    duplication: contains tandem repeat of two MBT repeats
  7. 1537518Species Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries)
  8. 1537523Domain d2vytb1: 2vyt B:31-126 [198459]
    automated match to d1oi1a1
    complexed with mlz, pge

Details for d2vytb1

PDB Entry: 2vyt (more details), 1.9 Å

PDB Description: the mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
PDB Compounds: (B:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2vytb1:

Sequence, based on SEQRES records: (download)

>d2vytb1 b.34.9.3 (B:31-126) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
ddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitg
arlrlrldgsdnrndfwrlvdspdiqpvgtcekegd

Sequence, based on observed residues (ATOM records): (download)

>d2vytb1 b.34.9.3 (B:31-126) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
ddfhweeylketgsisapsecfrqsqippvndfkvgmkleartsvciatvigitgarlrl
rldgsdnrndfwrlvdspdiqpvgtcekegd

SCOPe Domain Coordinates for d2vytb1:

Click to download the PDB-style file with coordinates for d2vytb1.
(The format of our PDB-style files is described here.)

Timeline for d2vytb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vytb2