| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
| Protein Scml2 protein [89300] (1 species) duplication: contains tandem repeat of two MBT repeats |
| Species Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries) |
| Domain d2vytb1: 2vyt B:31-126 [198459] automated match to d1oi1a1 complexed with mlz, pge |
PDB Entry: 2vyt (more details), 1.9 Å
SCOPe Domain Sequences for d2vytb1:
Sequence, based on SEQRES records: (download)
>d2vytb1 b.34.9.3 (B:31-126) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
ddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitg
arlrlrldgsdnrndfwrlvdspdiqpvgtcekegd
>d2vytb1 b.34.9.3 (B:31-126) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
ddfhweeylketgsisapsecfrqsqippvndfkvgmkleartsvciatvigitgarlrl
rldgsdnrndfwrlvdspdiqpvgtcekegd
Timeline for d2vytb1: