Lineage for d1faih1 (1fai H:1-123)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52517Species Fab R19.9 (mouse), kappa L chain [48766] (2 PDB entries)
  8. 52518Domain d1faih1: 1fai H:1-123 [19845]
    Other proteins in same PDB: d1faih2, d1fail2

Details for d1faih1

PDB Entry: 1fai (more details), 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d1faih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faih1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
tvs

SCOP Domain Coordinates for d1faih1:

Click to download the PDB-style file with coordinates for d1faih1.
(The format of our PDB-style files is described here.)

Timeline for d1faih1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1faih2