SCOP 1.71: Domain d2f19l1: 2f19 L:1-108

Lineage for d2f19l1 (2f19 L:1-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d2f19l1: 2f19 L:1-108 [19842]
   Other proteins in same PDB: d2f19h1, d2f19h2, d2f19l2
   part of Fab R19.9

Details for d2f19l1

PDB Entry: 2f19, 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d2f19l1:

Sequence; same for both SEQRES and ATOM records:

>d2f19l1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikr

Timeline for d2f19l1:

• d2f19l1 first appeared (with stable ids) in SCOP 1.55
  
• d2f19l1 appears in SCOP 1.69
  
• d2f19l1 appears in SCOP 1.73
  
• d2f19l1 appears in the current release, SCOPe 2.08