Lineage for d2vdhe2 (2vdh E:151-475)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100772Protein automated matches [226984] (9 species)
    not a true protein
  7. 2100776Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2100813Domain d2vdhe2: 2vdh E:151-475 [198406]
    Other proteins in same PDB: d2vdha1, d2vdhb1, d2vdhc1, d2vdhd1, d2vdhe1, d2vdhf1, d2vdhg1, d2vdhh1, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_
    automated match to d1wdda1
    complexed with cap, edo, mg; mutant

Details for d2vdhe2

PDB Entry: 2vdh (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdhe2 c.1.14.1 (E:151-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
pphgiqverdklnkygrgllgstikpklglsaknygravyeclrggldftkddenvnsqp
fmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdyl
tggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsgt
vvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpal
veifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsack
wspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2vdhe2:

Click to download the PDB-style file with coordinates for d2vdhe2.
(The format of our PDB-style files is described here.)

Timeline for d2vdhe2: