SCOPe 2.08: Domain d2uyla2: 2uyl A:113-218

Lineage for d2uyla2 (2uyl A:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2uyla2: 2uyl A:113-218 [198371]
   Other proteins in same PDB: d2uyla1, d2uylb_, d2uylm1, d2uyln_, d2uylv1, d2uylw_, d2uylx1, d2uyly_
   automated match to d1blna2

Details for d2uyla2

PDB Entry: 2uyl, 2.5 Å

PDB Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1

PDB Compounds: (A:) monoclonal antibody f-22-30

SCOPe Domain Sequences for d2uyla2:

Sequence; same for both SEQRES and ATOM records:

>d2uyla2 b.1.1.2 (A:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d2uyla2:

• d2uyla2 first appeared in SCOPe 2.03
  
• d2uyla2 appears in SCOPe 2.07