Lineage for d2uylm1 (2uyl M:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744574Domain d2uylm1: 2uyl M:1-112 [198372]
    Other proteins in same PDB: d2uyla2, d2uylm2, d2uylv2, d2uylx2
    automated match to d1blna1

Details for d2uylm1

PDB Entry: 2uyl (more details), 2.5 Å

PDB Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1
PDB Compounds: (M:) monoclonal antibody f-22-30

SCOPe Domain Sequences for d2uylm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uylm1 b.1.1.1 (M:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleik

SCOPe Domain Coordinates for d2uylm1:

Click to download the PDB-style file with coordinates for d2uylm1.
(The format of our PDB-style files is described here.)

Timeline for d2uylm1: