Lineage for d2qleb_ (2qle B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643577Protein automated matches [190406] (14 species)
    not a true protein
  7. 1643618Species Azotobacter vinelandii [TaxId:354] [188536] (1 PDB entry)
  8. 1643620Domain d2qleb_: 2qle B: [198308]
    automated match to d2qled_
    complexed with imd; mutant

Details for d2qleb_

PDB Entry: 2qle (more details), 1.59 Å

PDB Description: gfp/s205v mutant
PDB Compounds: (B:) Green fluorescence protein

SCOPe Domain Sequences for d2qleb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qleb_ d.22.1.1 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d2qleb_:

Click to download the PDB-style file with coordinates for d2qleb_.
(The format of our PDB-style files is described here.)

Timeline for d2qleb_: