SCOPe 2.06: Domain d2jb5l1: 2jb5 L:3-112

Lineage for d2jb5l1 (2jb5 L:3-112)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2jb5l1: 2jb5 L:3-112 [198100]
   Other proteins in same PDB: d2jb5h1, d2jb5h2, d2jb5l2
   automated match to d1lgva1
   complexed with t5c

Details for d2jb5l1

PDB Entry: 2jb5, 2.8 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-1

PDB Compounds: (L:) fab fragment mor03268 light chain

SCOPe Domain Sequences for d2jb5l1:

Sequence; same for both SEQRES and ATOM records:

>d2jb5l1 b.1.1.0 (L:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsn
rfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlg

Timeline for d2jb5l1:

• d2jb5l1 first appeared in SCOPe 2.03
  
• d2jb5l1 appears in SCOPe 2.05
  
• d2jb5l1 appears in SCOPe 2.07
  
• d2jb5l1 appears in the current release, SCOPe 2.08