Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d2jb5l1: 2jb5 L:3-112 [198100] Other proteins in same PDB: d2jb5h1, d2jb5h2, d2jb5l2 automated match to d1lgva1 complexed with t5c |
PDB Entry: 2jb5 (more details), 2.8 Å
SCOPe Domain Sequences for d2jb5l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jb5l1 b.1.1.0 (L:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} altqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsn rfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlg
Timeline for d2jb5l1: