Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226777] (4 PDB entries) |
Domain d2j9fb1: 2j9f B:14-204 [198096] Other proteins in same PDB: d2j9fa_, d2j9fb2, d2j9fc_, d2j9fd2 automated match to d1ik6a1 complexed with gol, k, mn, thv |
PDB Entry: 2j9f (more details), 1.88 Å
SCOPe Domain Sequences for d2j9fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9fb1 c.36.1.0 (B:14-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil yraaaeevpie
Timeline for d2j9fb1:
View in 3D Domains from other chains: (mouse over for more information) d2j9fa_, d2j9fc_, d2j9fd1, d2j9fd2 |