Lineage for d1ik6a1 (1ik6 A:1-191)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) 
there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
parent family to TK and PFOR
heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
automatically mapped to Pfam PF02779
Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species) 
Species Pyrobaculum aerophilum [TaxId:13773] [69473] (1 PDB entry) 
Domain d1ik6a1: 1ik6 A:1-191 [66174]
Other proteins in same PDB: d1ik6a2
structure determined on its own rather in the complex with E1-alpha
Details for d1ik6a1
PDB Entry: 1ik6 (more details), 2 Å
PDB Description: 3D structure of the E1beta subunit of pyruvate dehydrogenase from the archeon Pyrobaculum aerophilum
PDB Compounds: (A:) pyruvate dehydrogenaseSCOPe Domain Sequences for d1ik6a1:
Sequence, based on SEQRES records: (download)
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Pyrobaculum aerophilum [TaxId: 13773]}
vagvvmmanmakainmalheemerdervvvlgedvgkkggvflvteglyerfgpervidt
plneggilgfamgmamaglkpvaeiqfvdfiwlgadellnhiaklryrsggnykaplvvr
tpvgsgtrgglyhsnspeaifvhtpglvvvmpstpynakgllkaairgddpvvflepkil
yrapreevpeg
Sequence, based on observed residues (ATOM records): (download)
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Pyrobaculum aerophilum [TaxId: 13773]}
vagvvmmanmakainmalheemerdervvvlgelvteglyerfgpervidtplneggilg
famgmamaglkpvaeiqfvlgadellnhiaklrykaplvvrtpvgspeaifvhtpglvvv
mpstpynakgllkaairgddpvvflepkilyrapreevpeg
SCOPe Domain Coordinates for d1ik6a1:
Click to download the PDB-style file with coordinates for d1ik6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ik6a1:
- d1ik6a1 first appeared in SCOP 1.59
- d1ik6a1 appears in SCOPe 2.04
- d1ik6a1 appears in SCOPe 2.06
- d1ik6a1 appears in the current release, SCOPe 2.08
View in 3D
