Lineage for d2j21a_ (2j21 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2040932Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2041041Protein automated matches [190198] (2 species)
    not a true protein
  7. 2041042Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2041057Domain d2j21a_: 2j21 A: [198088]
    automated match to d2j21b_
    complexed with zn; mutant

Details for d2j21a_

PDB Entry: 2j21 (more details), 1.6 Å

PDB Description: human p53 core domain mutant m133l-v203a-n239y-n268d-r282w
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2j21a_:

Sequence, based on SEQRES records: (download)

>d2j21a_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdwrteeen

Sequence, based on observed residues (ATOM records): (download)

>d2j21a_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsvtctyspalnklfcqlaktcpvqlwvdstpppgtrvram
aiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhsvvvpy
eppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvcacpgr
dwrteeen

SCOPe Domain Coordinates for d2j21a_:

Click to download the PDB-style file with coordinates for d2j21a_.
(The format of our PDB-style files is described here.)

Timeline for d2j21a_: