![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
![]() | Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries) Uniprot P02768 29-596 |
![]() | Domain d2i30a3: 2i30 A:3-196 [198037] automated match to d1n5ua1 complexed with myr, sal |
PDB Entry: 2i30 (more details), 2.9 Å
SCOPe Domain Sequences for d2i30a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i30a3 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl delrdegkassakq
Timeline for d2i30a3: