Lineage for d2h0fa_ (2h0f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769735Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries)
  8. 2769738Domain d2h0fa_: 2h0f A: [197995]
    automated match to d2h0fb_
    complexed with aza

Details for d2h0fa_

PDB Entry: 2h0f (more details), 2.7 Å

PDB Description: crystal structure of pucm in the presence of 8-azaxanthine
PDB Compounds: (A:) Transthyretin-like protein pucM

SCOPe Domain Sequences for d2h0fa_:

Sequence, based on SEQRES records: (download)

>d2h0fa_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

Sequence, based on observed residues (ATOM records): (download)

>d2h0fa_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

SCOPe Domain Coordinates for d2h0fa_:

Click to download the PDB-style file with coordinates for d2h0fa_.
(The format of our PDB-style files is described here.)

Timeline for d2h0fa_: