| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc fingers and homeoboxes protein 1, ZHX1 [144141] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144142] (1 PDB entry) Uniprot Q9UKY1 60-95! Uniprot Q9UKY1 96-153 |
| Domain d2ghfa4: 2ghf A:60-95 [197953] ZnF 1 complexed with zn |
PDB Entry: 2ghf (more details)
SCOPe Domain Sequences for d2ghfa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghfa4 g.37.1.1 (A:60-95) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]}
nqqnkkveggyeckyctfqtpdlnmftfhvdsehpn
Timeline for d2ghfa4: