PDB entry 2ghf

View 2ghf on RCSB PDB site
Description: Solution structure of the complete zinc-finger region of human zinc-fingers and homeoboxes 1 (ZHX1)
Class: transcription, metal binding protein
Keywords: C2H2 zinc fingers; 4-stranded parallel/anti-parallel beta-sheet, Structural Genomics, Structural Proteomics in Europe, SPINE, TRANSCRIPTION, METAL BINDING PROTEIN
Deposited on 2006-03-27, released 2006-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc fingers and homeoboxes protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ZHX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKY1 (8-101)
      • cloning artifact (0-1)
      • expression tag (2-7)
    Domains in SCOPe 2.03: d2ghfa3, d2ghfa4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ghfA (A:)
mahhhhhhnqqnkkveggyeckyctfqtpdlnmftfhvdsehpnvvlnssyvcvecnflt
krydalsehnlkyhpgeenfkltmvkrnnqtifeqtindltf