| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (22 species) not a true protein |
| Species Sphingobium yanoikuyae [TaxId:13690] [225237] (2 PDB entries) |
| Domain d2gbwc2: 2gbw C:153-451 [197941] Other proteins in same PDB: d2gbwa1, d2gbwb_, d2gbwc1, d2gbwd_, d2gbwe1, d2gbwf_ automated match to d1eg9a2 complexed with fe, fes, oxy |
PDB Entry: 2gbw (more details), 1.7 Å
SCOPe Domain Sequences for d2gbwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbwc2 d.129.3.0 (C:153-451) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
eapsledylgefryyldtiwegagggmellgppmksllqcnwkvpaenfigdgyhvgwth
aaalsqiggelaglagnradipfddlglqfttrhghgfgvidnaaaglhikregwtkfle
dtrgevrrkfgpererlylghwncsifpncsflygtntfkiwhprgpheievwtytivpr
dadpatksmiqreairtfgtagtlesddgenmssatyinrgvitrngrmnstmgvgyegp
hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddtwdsvfpnrnfwnekln
Timeline for d2gbwc2: