Lineage for d1xgra2 (1xgr A:108-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294272Species Escherichia coli [TaxId:562] [224854] (11 PDB entries)
  8. 1294282Domain d1xgra2: 1xgr A:108-214 [197637]
    Other proteins in same PDB: d1xgra1, d1xgrc_
    automated match to d1dqdl2
    mutant

Details for d1xgra2

PDB Entry: 1xgr (more details), 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33I mutant complexed with hen egg lysozyme
PDB Compounds: (A:) HyHEL-63

SCOPe Domain Sequences for d1xgra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgra2 b.1.1.2 (A:108-214) automated matches {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1xgra2:

Click to download the PDB-style file with coordinates for d1xgra2.
(The format of our PDB-style files is described here.)

Timeline for d1xgra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgra1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xgrc_