![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [224854] (11 PDB entries) |
![]() | Domain d1xgra2: 1xgr A:108-214 [197637] Other proteins in same PDB: d1xgra1, d1xgrc_ automated match to d1dqdl2 mutant |
PDB Entry: 1xgr (more details), 2.1 Å
SCOPe Domain Sequences for d1xgra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgra2 b.1.1.2 (A:108-214) automated matches {Escherichia coli [TaxId: 562]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1xgra2: