SCOPe 2.03: Domain d1xgra1: 1xgr A:0-107

Lineage for d1xgra1 (1xgr A:0-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [224856] (13 PDB entries)

8. Domain d1xgra1: 1xgr A:0-107 [197636]
   Other proteins in same PDB: d1xgra2, d1xgrc_
   automated match to d1dqdl1
   mutant

Details for d1xgra1

PDB Entry: 1xgr, 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33I mutant complexed with hen egg lysozyme

PDB Compounds: (A:) HyHEL-63

SCOPe Domain Sequences for d1xgra1:

Sequence; same for both SEQRES and ATOM records:

>d1xgra1 b.1.1.0 (A:0-107) automated matches {Escherichia coli [TaxId: 562]}
mdivltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgip
srfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1xgra1:

• d1xgra1 is new in SCOPe 2.03-stable
  
• d1xgra1 appears in SCOPe 2.04
  
• d1xgra1 appears in the current release, SCOPe 2.07